{"title":"Books","description":"","products":[{"product_id":"thecatholicrunner30daysofmotivationandinspiration-bychriseasterly","title":"The Catholic Runner: 30 Days of Motivation and Inspiration - By Chris Easterly","description":"\u003cp style=\"box-sizing: border-box; border: 0px solid #e2e8f0; margin: 0px 0px 1.5rem; line-height: 1.8125; color: #333333; font-family: 'Open Sans', system-ui, -apple-system, system-ui, 'Segoe UI', Roboto, 'Helvetica Neue', Arial, 'Noto Sans', sans-serif, 'Apple Color Emoji', 'Segoe UI Emoji', 'Segoe UI Symbol', 'Noto Color Emoji'; font-size: medium;\"\u003eWhat if the Catholic Faith could make you a better runner?\u003c\/p\u003e\n\u003cp style=\"box-sizing: border-box; border: 0px solid #e2e8f0; margin: 0px 0px 1.5rem; line-height: 1.8125; color: #333333; font-family: 'Open Sans', system-ui, -apple-system, system-ui, 'Segoe UI', Roboto, 'Helvetica Neue', Arial, 'Noto Sans', sans-serif, 'Apple Color Emoji', 'Segoe UI Emoji', 'Segoe UI Symbol', 'Noto Color Emoji'; font-size: medium;\"\u003eWhat if running could make you a better Catholic?\u003c\/p\u003e\n\u003cp style=\"box-sizing: border-box; border: 0px solid #e2e8f0; margin: 0px 0px 1.5rem; line-height: 1.8125; color: #333333; font-family: 'Open Sans', system-ui, -apple-system, system-ui, 'Segoe UI', Roboto, 'Helvetica Neue', Arial, 'Noto Sans', sans-serif, 'Apple Color Emoji', 'Segoe UI Emoji', 'Segoe UI Symbol', 'Noto Color Emoji'; font-size: medium;\"\u003eBefore you toss these ideas out with your last pair of running shoes, take the next thirty days and put them to the test.\u003c\/p\u003e\n\u003cp style=\"box-sizing: border-box; border: 0px solid #e2e8f0; margin: 0px 0px 1.5rem; line-height: 1.8125; color: #333333; font-family: 'Open Sans', system-ui, -apple-system, system-ui, 'Segoe UI', Roboto, 'Helvetica Neue', Arial, 'Noto Sans', sans-serif, 'Apple Color Emoji', 'Segoe UI Emoji', 'Segoe UI Symbol', 'Noto Color Emoji'; font-size: medium;\"\u003eIn \u003cspan style=\"box-sizing: border-box; border: 0px solid #e2e8f0; font-weight: bolder;\"\u003eThe Catholic Runner: 30 Days of Motivation and Inspiration\u003c\/span\u003e, Catholic runner Chris Easterly becomes your personal trainer and running buddy, encouraging you with stories of his own running successes and failures, along with Scripture, saints quotes, and insights that will keep you going or get you started. The brief daily devotions come with a (totally doable) running challenge and a prayer to keep with you during your day.\u003c\/p\u003e\n\u003cp style=\"box-sizing: border-box; border: 0px solid #e2e8f0; margin: 0px 0px 1.5rem; line-height: 1.8125; color: #333333; font-family: 'Open Sans', system-ui, -apple-system, system-ui, 'Segoe UI', Roboto, 'Helvetica Neue', Arial, 'Noto Sans', sans-serif, 'Apple Color Emoji', 'Segoe UI Emoji', 'Segoe UI Symbol', 'Noto Color Emoji'; font-size: medium;\"\u003eWhether you’re preparing for a 5K or a marathon, or you want to start running to improve your health, during these thirty days you’ll notice changes. You’ll find yourself growing closer to God and becoming a better runner — and a better Catholic! — because you’ll be giving it all to him.\u003c\/p\u003e","brand":"Our Sunday Visitor","offers":[{"title":"Default Title","offer_id":45091832168692,"sku":"9781681924106","price":14.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/e9b94d4dd739c55021711e05964f29356a06bb3f.gif?v=1714242997"},{"product_id":"thegiftoflivinginthedivinewillin-byrevjosephleoiannuzzi","title":"The Gift of Living in the Divine Will in the Writings of Luisa Piccarreta - by Fr. Joseph Iannuzzi","description":"\u003cblockquote\u003e\n\u003cp\u003eDue to increased costs, this book has increased past it's original sticker price ($35). Thank you for your understanding.\u003c\/p\u003e\n\u003c\/blockquote\u003e\n\u003cp\u003eby Fr. Joseph Iannuzzi7, 68 pages    Known for his previous best selling Catholic books such as, The Splendor of Creation and Proper Catholic Perspectives, Rev. Dr. Joseph L. Iannuzzi's long awaited book, The Gift of Living in the Divine Will in the Writings of Luisa Piccarreta, is finally available. Over 700 pages in length, Iannuzzi's thoroughly documented and highly researched account of Piccarreta's life is unparalleled in its scope and depth, and is the definitive work of the life and writings of Luisa Piccarreta.   Born in 1865 in Corato, Italy, Luisa Piccarreta began receiving revelations at age 12 and was called by God to become a victim soul.  At a very tender age God spoke to her about a gift he wishes to bestow upon the world that will set it free and inaugurate an Era of World Peace. God refers to this gift as “Living in the Divine Will”, for it is through an act of God’s will that the earth will be made pure and mankind will become holy. Just as God the Father created the world, and the Son of God redeemed it, so the Holy Spirit will sanctify it through the outpouring of this gift.             According to Luisa’s revelations, although God created us without us, he cannot save us without us. Therefore, he reveals himself to Luisa so that through her, we may come to know the loving gift he has prepared for us – the gift that will restore us to the holiness that Adam and Even enjoyed in Eden, and that will set all creation free.  St. Paul affirms that “all creation groans with eager longings, waiting to be set free from its slavery to corruption and enjoy the glorious freedom of the sons of God,” and God tells Luisa that those who live in the Divine Will will be those sons of God who set creation free.             This book is divided into 7 chapters.  Chapter 1 presents a biographical sketch of Luisa’s life; Chapters 2-4 explore the importance of the gift of Living in the Divine Will; Chapters 5-7 compare this gift to the Church’s Eastern and Western traditions.  Because this book bears the ecclesiastical “seal of approval” of the Pontifical University of Rome that is authorized by the Holy See, it enjoys a particular status that ensures sound doctrinal content for the Christian faithful.             If you are familiar with the extraordinary life of Luisa Piccarreta, then this book will truly bring you deeper into her life and the gift of the “Divine Will”.  If you are not, then you are truly in for a special and extraordinary experience that will change your life.  It is a story perhaps unparalleled in the history of mystical theology, written by whom many consider the Church’s most authoritative person on the subject.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eISBN: 9781891903410\u003c\/p\u003e","brand":"St. Andrew Productions","offers":[{"title":"New","offer_id":48009899507956,"sku":"9781891903410","price":45.0,"currency_code":"USD","in_stock":false},{"title":"Used","offer_id":48009899540724,"sku":"U3411","price":20.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/a62fae33f7c36abbb285ec37e9a7c8a1a64b151d.jpg?v=1714243008"},{"product_id":"integrity-restored-helping-catholic-families-win-the-battle-against-pornography-by-peter-c-kleponis-phd","title":"Integrity Restored - Helping Catholic Families Win The Battle Against Pornography By Peter C. Kleponis, PhD","description":null,"brand":"St. Paul Center for Biblical Theology | Emmaus Road Publishing","offers":[{"title":"Default Title","offer_id":45091833282804,"sku":"9781940329918","price":17.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/9781940329918-us.jpg?v=1714243010"},{"product_id":"tailsofthesecretpeacock-bylynnkkilbride","title":"Tails of the Secret Peacock: The Beginning of Wisdom - By Lynn K. Kilbride","description":"\u003cp\u003eWhat if the gifts of the Holy Spirit came to life? Follow Sagesse Fontaine and her band of intriguing heroines as they use their gifts and their wits on adventures all over the world!\u003cbr\u003e\u003cbr\u003eAuthor: Lynn K. Kilbride\u003c\/p\u003e","brand":"Sacred Spaces Group","offers":[{"title":"Default Title","offer_id":45091833544948,"sku":"9781733492805","price":14.99,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/1e70212a06355ab2d50c1b6197e41ee70fe887e8.jpg?v=1714243021"},{"product_id":"theconversionofmarie-alphonseratisbonne","title":"The Conversion of Marie-Alphonse Ratisbonne - by Baron Théodore deBussieries","description":"\u003cp\u003eISBN: 1930278853\u003c\/p\u003e\n\u003cp\u003eAuthor: Baron Théodore deBussieries\u003c\/p\u003e\n\u003cp\u003ePages: 80\u003c\/p\u003e\n\u003cp\u003eBinding: Paperback\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eAlphonse Ratisbonne was a French Jew who was miraculously converted while at Rome in the Church of San Andrea della Frate. His brother had previously converted and become a Catholic priest, but Alphonse hated the Catholic church and vowed never to enter.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eThis is the story of the power of prayer and a miracle of grace. It is a powerful, delightful, and consoling story that every apostolic Catholic should know.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eThis is how Ratisbonne related his experience in the church that cold day in January of 1842. “All I can say is that the moment when the Blessed Virgin made a sign with her hand, the veil fell from my eyes; not one veil only, but all the veils which were wrapped around me disappeared, just as snow melts beneath the rays of the sun.’ ‘I am asked how I attained a knowledge of these truths, since it is well known that I never opened a religious book, had never read a page of the Bible, and that the dogma of original sin, which is either denied or utterly forgotten by the modern Jews, had never for a single moment occupied my thoughts—indeed, I doubt whether I had ever heard the words which express it. How, then, did I arrive at a knowledge of it? I know not. All that I know is that when I entered that church I was profoundly ignorant of everything, and that when I came out I saw everything clearly and distinctly.”\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eBaron de Bussieres states, “We have given in this volume a literal translation of the original accounts of the conversion of M. Alphonse Ratisbonne along with many other letters and documents relating to the miraculous conversion.” \u003c\/p\u003e\n\u003cp\u003eThis edition is faithful to the original published in 1842.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eAuthor's Preface (FULL)\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eWe have given in this volume a literal translation of the original accounts of the conversion of M. Alphonse Ratisbonne. The attempt to construct an independent narrative would be presumptuous in itself, and would lose the simple force and freshness of these genuine documents. Those who know the scrupulous and almost suspicious care with which the pretensions of any alleged miracle are tested at Rome, will feel the value of the decree of the Cardinal-Vicar which is prefixed. Baron de Bussières prefaced his first edition with a declaration, that he claimed for his narrative only that measure of assent which may be granted to any ordinary statement, resting on human evidence alone; this decree has raised the conversion of Mr. Ratisbonne to the position of an accredited miracle.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eIt is both sad and strange to observe the air of superb disdain with which miracles such as this are set aside, even by those who seem least removed from the Church, and who profess to accept the miracles of  Holy Scripture on their  own  evidence, and to be familiar with the laws of moral reasoning.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eAnd yet, surely, those who reject this statement as an imposture or a delusion, should feel bound to show wherein it lacks the criteria of a true miracle. We may assume that they will be unwilling to affirm that the power of working miracles was restrained within the limits of the apostolic age; they know that this hypothesis is fatal to historical Christianity, and belies the promise of its inspired records. Nor will they say that a miracle is so improbable a thing in the kingdom of God that no amount of testimony can render it credible; they know well, that on this view, they could hardly rescue the miracles of the Gospels from the hands of unbelievers.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eThey must rest their rejection on one of these grounds: they either regard the evidence for this particular miracle as insufficient or untrustworthy, or they shrink from doctrines and practices which seem to them imbedded in it, or presupposed by it.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eYet they have learned from a great authority amongst themselves,1 that objections to any revelation from God, as distinguished from objections to its evidence, are frivolous.  It is not competent to them to set aside credible testimony to a miracle, simply because that miracle carries with it  theological consequences which they deem at variance with the general scheme of religion. Nor would they thus reserve any right to blame the Jews for rejecting our Lord’s miracles. The only question which they can logically entertain is the evidence for this particular miracle — the apparition of the Blessed Virgin to Alphonse Ratisbonne in the church of St. Andrew at Rome.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eAnd if we weigh the character of the witness and his competency — the improbability of his being deceived or wishing to deceive — the simple fact of the entire change wrought upon him in a moment, in the conversion of his heart and the illumination of his mind; the consequences of his testimony to himself; and then, the many years which have tested his sincerity and his stability; — if we weigh all these circumstances, we may ask whether it is possible to decline to receive his testimony on any grounds which would not excuse the Jews that dwelt at Damascus for refusing to credit the conversion of Saul of Tarsus, and Festus for deeming him mad. We repeat, that those who feel that there is no antecedent improbability in the occurrence of miracles, that the later miracles cannot be discredited on a priori grounds without shaking the credit of those of the Gospels, are bound to justify their rejection of this miracle by impeaching its evidence. This is the only issue which a Christian can properly raise; and that testimony cannot be trivial or indifferent which the Church has stamped with the seal of its acceptance.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eBut here we would invite attention to some weighty and suggestive remarks of Cardinal Wiseman, in his review of a pamphlet entitled A Voice from Rome.2\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eIn proof that the Blessed Virgin is honored as the Mother of mercies, temporal and spiritual, the author before us appeals to the Baron de Bussières’ account of M. Ratisbonne’s conversion from Judaism, which he distinctly attributes to the immediate operation of the Virgin Mary; for he relates, that it was effected by her actual appearance to him.  Now, what is meant to be granted, and what is meant to be doubted here, we do not know. We suppose that no one doubts that M. Ratisbonne, from a Jew, did become a Catholic, and has become a religious; having abandoned home and friends, and given up a long-cherished alliance. Any one might as well deny that Sir R. Peel is Prime Minister. That he went into the church of St. Andrew a Jew, and came out a Christian, is attested upon evidence as certain as any fact can well be that of trustworthy and honest men, who saw him and spoke with him before and after. For the change something must account. That it was a true conversion from Judaism to Christianity, with great temporal sacrifices, is clear; and such a conversion must have been the work of divine grace. How communicated is the question. The only witness can be the convert. He tells us that it was through an apparition of the Mother of God, who instructed him in the mysteries of our holy religion. Are we to believe that a person is chosen by the Divine Goodness for an object of a most singular act of grace, at the moment that he devises and tells an abominable falsehood, to rob Him of the glory of it, and give it to another, by feigning a vision of the Blessed Virgin? What does the author of the Voice mean to throw doubt on? on the apparition, as for such a purpose impossible? or on the consequences drawn from it? Surely not on the latter; for if the vision was true, it was right to consider the blessed Mother of God, not as the source, but as the channel, of a great spiritual mercy.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eIf he wishes to insinuate that it would be derogatory to God’s honor, or incompatible with His revealed doctrines, to believe such a mode of communicating grace and religious instruction possible, and consequently, that the whole must be a figment or a delusion, we will, in answer, relate another similar story, in which not a Jew, but a bishop, was the party; and we will premise that we have it on the best authority.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eThe person to whom we allude was a young man of singular piety and virtue. Left young an orphan, he devoted his youth to study in a celebrated university. There his assiduity in learning was surpassed only by the purity and innocence of his life, which stood the test of severe trials, and escaped the snares laid for him by profligate companions, jealous of his virtue. Having made himself master of all profane learning, he entered on a course of sacred studies, under the most celebrated professor of the day, and soon made considerable progress. He was, however, while yet young, put into orders, and even named bishop, before he considered himself well enough grounded in theological knowledge; though probably his humility led him to exaggerate his deficiencies. He found himself quite unequal to the task of preaching the Divine Word; and on the eve of his first undertaking this duty, he lay sleepless on his bed, in agitation and anxiety. Suddenly he saw before him a venerable figure of an old man whose countenance, attitude, and garb bespoke great dignity, but who, at the same time, appeared most gracious and affable. Terrified at this appearance, he leaped from his couch, and respectfully asked who he was, and for what purpose he had come. The old man replied, in a gentle voice, that he had come to calm his doubts and solve his difficulties. This declaration soothed his fears, and made him look towards his visitor with a mixture of joy and awe; when he perceived, that by steadily pointing with his hand towards the other side of the apartment, he seemed to wish to turn his attention in that direction. Thither be consequently turned his eyes, and there he beheld a lady of peerless majesty, and of more than human beauty, so resplendent that his eyes could not bear the brightness of the vision, but he must needs bend them and his countenance down, in reverential awe. Thus be listened to the conversation of these two heavenly beings, which fully instructed him on the subjects whereon he felt anxious, and at the same time informed him who his gracious visitors were. For the lady, addressing the other by the name of the Evangelist John, requested him to instruct the youth in the mystery of heavenly piety; and he replied, ‘that he was ready to do even this, to please the Mother of his Lord, seeing that she desired it.’ And accordingly he did so.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eSuch is our counterpart to the narrative objected to by our author, respecting M. Ratisbonne’s conversion. Now, before giving the name of our authority for this wonderful history, or of the person to whom it refers, we will only beg our reader, if not sufficiently versed in ecclesiastical biography, at once to answer both points, to say to what church or religion he considers either the writer or the subject of this anecdote belongs.  Could he believe us if we told him that it happened to Bishop Ken, or Bishop Wilson, or Archbishop Laud; or that we had transcribed it, as gravely told by some Anglican clergyman in a life of any of them? We are sure he could not. The idea of a Protestant bishop learning his faith from a vision of the Blessed Virgin would be deemed repugnant to every principle and every feeling of the religion. But were we to tell the reader that the bishop spoken of was St. Alphonsus Liguori, or even St. Charles, and the narrator an Italian monk or priest, he would at once allow, that such an account, from such a pen, concerning such a person, was perfectly consistent with the principles of both; and though, if a Protestant, he might declare that he did not believe the story, he would acknowledge that it did not surprise him to find it in such a place. It must, then, be a Catholic, and not a Protestant, who thought or said he saw such a vision; and it must be a Catholic, and not a Protestant, who has recorded it, as believing it. And so it was. The bishop who thus learnt his faith was St. Gregory Thaumaturgus, only little more than two hundred years after Christ; and the recorder of the vision is the brother of the great St. Basil, St. Gregory, Bishop of Nyssa. This would have been a nice anecdote for our ancient note-taker upon the doctrines of Catholics.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eThe real reason why miracles such as this are rejected with scorn, or passed by with indifference, is not their antecedent improbability nor the inadequacy of their evidence; it is that they imply and render sensible the position and power of the blessed Mother of God. The Protestant cannot endure that glad and graceful vision of the Mother of Divine Grace — radios evibrans misericordiae — as Catholic piety delights to image her. It is an offence to him. It is something so intolerable to him, that, in his antipathy, he forgets all canons of moral reasoning; his conceptions and definitions become confused, and he allows this consoling vision to neutralize the positive evidence, that the Church which discloses it is alone of God.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eAnd yet waiving in thought what we can never forget in fact, that clear voice of the Church which is the Catholic’s warrant of faith, why should it be thought a thing so violently incredible that the Mother of God should occupy the position, and exercise the powers, ascribed to her by the Church?  Surely there can be no natural and necessary improbability in that which East and West combine to affirm. Except in the fancies of a modern and very small section of the nominally Christian world, there has never been any consciousness of an incompatibility between our assigned office and the Gospel. Her glories and prerogatives, as Mother of Christians and a special channel of grace, have not shocked the wisest and the holiest sons of the Church.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eNor can those who rightly ascribe so tremendous an influence to Eve over the destinies of our race, rightfully shrink from the range of power attributed by the Church to the advocate and counterpart of Eve. It cannot, surely, be a gratuitous fancy to see in the effects of the unbelief and disobedience of the mother of all living, in the order of nature, a hint and a measure, though not a limit, of the efficacy of the faith and obedience of the mother of all living, in the order of grace.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eBut let us  observe here, that the miraculous element in the conversion narrated in this volume is simply the apparition of the blessed Mother of God, and not her intercessory power. The Catholic regards that power as a supernatural fact, a law of the spiritual kingdom, one of the powers of the world to come. He needs no miracle to teach him that. No number or splendor of miracles could increase his faith in that. They would be but verifications to sense of what he knows already, absolutely and infallibly, by the teaching of the Church; what he sees already, by the deep intuition of faith. Such a miracle as this might excite his faith, but could not be its ground or warrant. He sees the office and the prerogatives of the Blessed Virgin involved in the fact of the Incarnation. Mary, of whom was born Jesus — he needs no more. Mary, Mother of God; Mary, bequeathed to us as our mother from the Cross: the Divine Maternity includes and implies all. Her glories and her mighty powers are only its natural consequences, and its fitting adornment.\u003c\/p\u003e\n\u003cp\u003eIs he reminded of the absence of express command to seek her intercession? He feels that he has the command of that same Spirit by whose inspiration Scripture was written. For the Church can ever say, it hath thus seemed good to the Holy Ghost and to us. He would remind the objector, that the relation in which the Mother of God stands to us being known, the duty of religious regard to her, on Bishop Butler’s principles, arises out of that relation itself, and is an obligation of reason, binding as soon as that relation is known. It is our duty as well as our privilege to seek the intercession of those who have power with God; and he would call on the objector to produce some prohibition of so natural an exercise of that privilege. And, indeed, Catholics feel that this objection does strike at intercessory prayer in general. There, we know, an intercession, vast and mighty, which rests upon and carries out, if we may so speak, the great mediation of the Word made flesh; and that mediation is a legitimate object of desire, and consequently of petition, to every Christian man. It is for the objector to produce a command in limitation of this our right, in the covenant of grace.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eBut then, to invoke the Blessed Mother, to imagine that she can hear our cry and turn on us her pitying eyes – it is this which is deemed so absurd as to need no refutation. As if the charge of absurdity did not recoil on those who, with gross conceptions, impose on the world unseen the laws of space and time and the like, which rule this world that is seen; who dare to limit the range of the perceptions of the blessed by the laws of man’s bodily senses, senses which are but the spirit’s points of contact with the material world. Surely, it is both shallow and unscientific to reason from the senses of this body of our lowness, to the powers and perceptions of the saints who reign with Christ. Be it so, that we know not precisely how the Saints hear our invocation. It is enough, to turn the force of this objection drawn from our ignorance, to say that we can conceive many ways in which they may know the desires of our hearts. It is quite enough for the Catholic to say: what if:           \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e         A sea before\u003c\/p\u003e\n\u003cp\u003e        The throne is spread; its pure still glass \u003c\/p\u003e\n\u003cp\u003e        Pictures all earth-scenes as they pass. \u003c\/p\u003e\n\u003cp\u003e        We, on its shore,\u003c\/p\u003e\n\u003cp\u003e        Share, in the bosom of our rest,\u003c\/p\u003e\n\u003cp\u003e        God’s knowledge, and are blest.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eStill there is a jealousy, honorable in its motive, most unwise in its conclusions, that our recourse to the Blessed Mother of Christians does in some way interfere with the simplicity of our trust in Jesus. It is impossible for those who are without, to understand the practical and ever-present safeguards of the Catholic from all error, from all excess. They cannot know, for instance, the effect of the Mass in regulating all his language and thoughts; nor how impossible it is that this perception of the greatness of the powers which God does communicate to the creature should lessen the greatness or dim the glory of those which are incommunicable. Surely it should suffice to affirm that the sole Mediatorship of the Incarnate Son of God is the very condition of all Catholic theology and practice. Like the weakness of man and  the might of grace, it is a law of the spiritual order, everywhere felt, everywhere presupposed, everywhere taken for granted, underlying every statement, pointing every prayer. It is not so much a part of the Gospel, as the Gospel itself. But the intercession of the Blessed Virgin and of the saints cannot be so stated as to clash with this oneness of mediation. They cannot ask otherwise than in accordance with His will, nor apart from His great pleading. It is upon that golden altar, which is before the throne of God, that the prayers of all saints are offered, in St. John’s vision. Now this is ever present to the Catholic. However largely he may ask of our Blessed Mother — and he does ask largely — the principle of his asking and the law of its interpretation are, Tu da, per precata dulcisona (by thy sweet prevailing prayer). However wide and, to human notions unlimited, the range of power he ascribes to the Mother of God, it abides still an omnipotentia supplex, as St. Bernard beautifully says. It cannot be otherwise to him. He is never even tempted to confound the creatures with the Creator, to mistake the streams for the source.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eBut, indeed, it is not the illumination of the mind that is needed to bring back the strayed sheep to the fold; it is the attraction of the heart and the bending of the will, and this is the work of God alone. Would those who doubt and object but meditate awhile on the solitary prerogative of Mary, on her proximity to the flesh of Jesus, and on the intensity of the mutual love that must bind together that Son and that Mother; would they but try to look at her revealed position from the Church’s point of view. with all those limitations and checks and safeguards of which they can form no notion; would they do this, not with the hard cold gaze of the intellect, but with a loving docile heart; the objections which now hang like clouds before their soul’s eye would melt away of themselves and leave no trace. To such a one we would say, in all affection, if you must reason ere you believe, remember the laws which control all moral reasoning; remember that no number of even irreducible objections3 are of weight against that which rests upon direct and positive evidence; remember that though this evidence is liable to objections, and may be run up into difficulties, it is not lost in these difficulties or destroyed by these objections; remember that those who, like St. Bernard, St. Anselm, St. Bonaventure, St. Alphonsus, have been most devout to Mary, have spoken of Jesus with the tongues of angels rather than of men; and pray — ova fortiter et fideliter. And as you gaze, you will see how the Mother of Jesus is the mother of His mystical body likewise — Mater membrorum Ejus, as St. Augustine speaks. As you fathom the import of the words, Behold the handmaid of the Lord, you will come to feel that it is a mighty plea and an availing, to say, Behold, O Lord, how that I am Thy servant, and the son of Thine handmaid; and you will soon be enabled to continue the words of the psalm, Thou hast broken my bonds asunder.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eWe owe an apology to our Catholic readers for the length to which these remarks have extended. You can hardly grasp the reality of the difficulty which Protestants feel in the intercession of the Blessed Virgin and of the saints. You can scarcely believe that men, believing the mystery of the Incarnation, can really confound things so accordant indeed, yet so distinct, as the affiance of a Christian in Christ, and his recourse to the prayers of all saints, without intellectual weakness or moral perversity. To you the miracle related here is, if I may so speak, quite natural and in keeping; wonderful indeed, but still what you are prepared to expect from the Mother of Mercy.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eTo you all Scripture speaks of her, in type and figure, in prophecy and promise. To you the Incarnation is unintelligible apart from her, and doctrine heterodox or unmeaning which makes no mention of her. You know that as you have loved Jesus more, you have felt for her whom He loved best on earth, whom He cannot but delight to honor in heaven — a truer, deeper, more loyal, and more trustful love; and that as your devotion to the Mother of God has gathered strength, you have known and loved Jesus with a less reserved and less reserving love. You know and feel that God has indeed done great things unto her; but it has never occurred to you that He has thereby dimmed the glory of His name. You have rather said with her — et sanctum nomen Ejus.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eThis narrative is of conversion, of Mary’s tender pity towards those who know her not. How can we better express our thankfulness for this instance of her compassion than by praying for those to whom that very compassion is an offence and a hindrance? We know, by manifold experience — we have heard with our ears, and our fathers have declared it to us — the reality, the range, and the patience of that compassion. Let us pray for those who, from amidst their gathering gloom, are casting wistful, timid looks towards the one unwavering light, that God’s grace may still lead them on, and gently clear their way through their thorny objections, until it brings them under Mary’s smile and Peter’s royal feet.\u003c\/p\u003e","brand":"Loreto Publications","offers":[{"title":"Default Title","offer_id":45091833905396,"sku":"9781930278851","price":11.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/d03305acf31e51d20faecfe2371b5e48526d57c8.jpg?v=1714243032"},{"product_id":"my-god-and-my-all-by-fr-fx-lasance","title":"My God And My All By Fr. F.X. Lasance","description":"\u003cp\u003e\u003cstrong\u003eBy Father F. X. Lasance - 1922 Edition\u003cbr\u003eBlack Leather hardcover – 296 pages\u003cbr\u003e\u003c\/strong\u003eAs the composer of numerous volumes, Father Lasance is the master of prayerbooks for Catholics. This is his shirt-pocket size contribution designed especially for children and loved by many adults as well. This handy little book makes a perfect gift for First Communions, Confirmations, birthdays, etc. It contains the responses for serving Low Mass, as well as morning and evening prayers, litanies, pious ejaculations, devotions for Confession and communion, and many other essential Catholic prayers.\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003e• Black leather embossed cover\u003c\/li\u003e\n\u003cli\u003e• Gold stamped cover\u003c\/li\u003e\n\u003cli\u003e• 3\"” x 5\"” book format\u003c\/li\u003e\n\u003cli\u003e• Rounded corners\u003c\/li\u003e\n\u003cli\u003e• Quality paper\u003c\/li\u003e\n\u003c\/ul\u003e","brand":"Loreto Publications","offers":[{"title":"Default Title","offer_id":45091834102004,"sku":"9781622921676","price":19.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/small_MGMA-Cover.jpg?v=1714243042"},{"product_id":"a-textual-concordance-of-holy-scripture-arranged-by-topic-and-giving-the-actual-passages-by-fr-thomas-david-williams-2311","title":"A Textual Concordance of Holy Scripture: Arranged by Topic and Giving the Actual Passages - by: Fr. Thomas David Williams","description":"\u003cp\u003e\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eAlphabetical, topic-by-topic selection of passages from the Bible, originally compiled to help priests prepare sermons. Over 1,900 topics and 18,000 actual Bible verses! Unlike other concordances, this one quotes the actual passages in full. Unparalleled introduction to Bible reading. A quick way to learn just what the Bible says on a host of topics. Truly a one volume Bible study course and a great aid to unlocking the true Catholic meaning of Scripture. Great for reference. Impr. 848 pgs.\u003c\/p\u003e\n\u003cp\u003eAuthor: Fr. Thomas David Williams\u003cbr\u003ePages: 854\u003cbr\u003ePublication Date: 4\/1\/2010\u003cbr\u003eProduct Format: Hardcove\u003c\/p\u003e","brand":"Tan Books | St. Benedict Press","offers":[{"title":"New","offer_id":47839122260212,"sku":"9780895552860 9790895552869","price":44.95,"currency_code":"USD","in_stock":true},{"title":"Used Paperback","offer_id":47839122292980,"sku":"0895552868","price":20.0,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/shopping_1.png?v=1758571294"},{"product_id":"themassactivitybook-deborahcjohnson","title":"The Mass Activity Book - Deborah C. Johnson","description":"\u003cp\u003eThis Aquinas Kids® Growing in Faith Activity Book will help children learn more about the gift of the Mass. Through coloring, puzzles, mazes, dot-to-dot and more, they will actively connect in a unique way with Jesus and His gift of Himself in the Mass. Ages 5-9.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eThe peace of the Lord be with you always.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eMaterial: Paperback\u003c\/p\u003e\n\u003cp\u003eSize: 7-1\/2 x 10-1\/4\" H, 32 pgs\u003c\/p\u003e","brand":"Christian Brands","offers":[{"title":"Default Title","offer_id":45091834790132,"sku":"9781617962134","price":2.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/f2ae325e2fe1bab4c897f96c73ba0331474c08e0.jpg?v=1714243056"},{"product_id":"acatholicintroductiontothebible-theoldtestamentbyjohnbergsmabrantpitre","title":"A Catholic Introduction to the Bible - The Old Testament by  John Bergsma \u0026 Brant Pitre","description":"\u003cp\u003eAlthough many Catholics are familiar with the four Gospels and other writings of the New Testament, for most, reading the Old Testament is like walking into a foreign land. Who wrote these forty-six books? When were they written? Why were they written? What are we to make of their laws, stories, histories, and prophecies? Should the Old Testament be read by itself or in light of the New Testament?\u003c\/p\u003e\n\u003cp\u003eJohn Bergsma and Brant Pitre offer readable in-depth answers to these questions as they introduce each book of the Old Testament. They not only examine the literature from a historical and cultural perspective but also interpret it theologically, drawing on the New Testament and the faith of the Catholic Church. Unique among introductions, this volume places the Old Testament in its liturgical context, showing how its passages are employed in the current Lectionary used at Mass.\u003c\/p\u003e\n\u003cp\u003eAccessible to nonexperts, this thorough and up-to-date introduction to the Old Testament can serve as an idea textbook for biblical studies. Its unique approach, along with its maps, illustrations, and other reference materials, makes it a valuable resource for seminarians, priests, Scripture scholars, theologians, and catechists, as well as anyone seeking a deeper understanding of the Bible.\u003c\/p\u003e\n\u003cp\u003eFormat: Hardback\u003cbr\u003eISBN\/UPC: 9781586177225\u003cbr\u003eLength: 2.38 (in)\u003cbr\u003eSize (HxW): 10.25 x 7.25 (in)\u003cbr\u003ePages: 1060\u003cbr\u003ePublication date: July 12, 2018\u003cbr\u003eWeight: 64 oz\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","brand":"Ignatius Press","offers":[{"title":"Default Title","offer_id":45091835248884,"sku":"IOTH","price":55.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/IOTH_r__86398-1617023799.jpg?v=1714243073"},{"product_id":"puremanhoodbyjasonevert","title":"Pure Manhood by Jason Evert","description":"\u003cp\u003eYoung men deserve straight answers to tough questions about women, dating, sexuality, and authentic masculinity, including…\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eWhat do girls want?\u003c\/p\u003e\n\u003cp\u003eHow far is too far?\u003c\/p\u003e\n\u003cp\u003eWhat’s wrong with just thinking about it?\u003c\/p\u003e\n\u003cp\u003eWhat’s wrong with porn? You’re not hurting anyone.\u003c\/p\u003e\n\u003cp\u003eWhat if it’s just a swimsuit magazine?\u003c\/p\u003e\n\u003cp\u003eIf she’s willing to do it, why is it wrong?\u003c\/p\u003e\n\u003cp\u003eWhat about safe sex?\u003c\/p\u003e\n\u003cp\u003eShouldn’t I be free to do whatever I want?\u003c\/p\u003e\n\u003cp\u003eHow do I stay pure\u003c\/p\u003e\n\u003cp\u003ePure Manhood answers these questions and more, while offering practical strategies to help young men to grow in the virtue of chastity.\u003c\/p\u003e","brand":"Chastity Project","offers":[{"title":"Default Title","offer_id":45091835871476,"sku":"9780989490528","price":2.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/64937d29359c04bb958942fe66bc6bf42bd8760d.png?v=1714243091"},{"product_id":"anexorcistexplainshowtohealthepossessedandhelpsoulssufferingspiritualcrises-byfrpaolocarlin","title":"An Exorcist Explains How to Heal the Possessed: And Help Souls Suffering Spiritual Crises - by Fr. Paolo Carlin","description":"\u003cp\u003eFrom one of the world’s leading exorcists comes this eye-opening book to help you recognize genuine cases of diabolical possession — and know what to do when your friends or family show behaviors that leave you suspicious.\u003c\/p\u003e\n\u003cp\u003eLeaning heavily on Scripture and the teachings of the Church, as well as on his own extensive experiences as an exorcist, Fr. Paolo Carlin here unveils Satan’s plan of attack while giving you the telltale signs that the Evil One is at work in your life or in the life of others.\u003c\/p\u003e\n\u003cp\u003eYou’ll learn the special conditions that facilitate the work of the devil — particularly ones that appeal to the youngest and most defenseless among us.\u003c\/p\u003e\n\u003cp\u003eArmed with knowledge of the antics of Satan, Fr. Carlin also enumerates the many spiritual weapons that Our Lord has placed at our disposal. Best of all, you’ll learn to employ each one  effectively to keep the devil and his army of fallen angels at bay.\u003c\/p\u003e\n\u003cp\u003eFinally, Father will show you how to distinguish between mental illnesses and diabolical attacks, as well as how to determine when you must turn away from amateur efforts and urgently seek  the expert help of an official exorcist.\u003c\/p\u003e\n\u003cp\u003eAn Exorcist Explains How to Heal the Possessed is a much-needed guide for priests, educators, parents, and, indeed, for anyone struggling to keep the door to Satan closed.\u003c\/p\u003e","brand":"Sophia Institute Press","offers":[{"title":"Default Title","offer_id":45091835937012,"sku":"9781622825202","price":14.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/5ea83aec3b274234b44370f4c3fc0a3d427dbed2.jpg?v=1714243093"},{"product_id":"dailymeditationsonthepsalms","title":"Daily Meditations On The Psalms by Rev. Msgr. C. Anthony Ziccardi","description":"\u003cp\u003e\u003cspan style=\"color: #404040; font-family: 'Helvetica Neue', Helvetica, Arial, 'Lucida Grande', sans-serif; font-size: 12px;\"\u003eFor each day of the year, features a quote from the Psalms, a reflection upon the text, and a prayer.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003ePages: 192\u003c\/p\u003e\n\u003cp\u003eAuthor: MSGR. C. ANTHONY ZICCARDI\u003c\/p\u003e\n\u003cp\u003eSize: 4 X 6 1\/4\u003c\/p\u003e\n\u003cp\u003eCover: GREEN\u003c\/p\u003e\n\u003cp\u003eBinding: IMITATION LEATHER\u003c\/p\u003e","brand":"Catholic Book Publishing","offers":[{"title":"Default Title","offer_id":45091838198004,"sku":"18919","price":11.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/ca172e59eca9c81a16ee0cd8e0d9fb1cf0bc64b3.jpg?v=1714243151"},{"product_id":"goodstanne-byanonymous","title":"Good St. Anne - by:  Anonymous","description":"\u003cp\u003eSt. Anne, the beloved Mother of Our Lady and Grandmother of Our Lord, has proved herself a heavenly helper in every need. She is especially invoked as Patroness of Mothers, Comfort of the Sorrowing, Mother of the Poor, Health of the Sick, Patroness of the Childless, Help of the Pregnant, Model of Married Women and Mothers, Protectress of Widows and Patroness of Laborers.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eProduct Details\u003c\/p\u003e\n\u003cp\u003eReviews (0)\u003c\/p\u003e\n\u003cp\u003eItem No:   1581\u003c\/p\u003e\n\u003cp\u003ePages:   63\u003c\/p\u003e\n\u003cp\u003eISBN:   9780895556417\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003ePublication Date:   2009\u003c\/p\u003e\n\u003cp\u003eBinding:   Saddlestitch\u003c\/p\u003e\n\u003cp\u003eDimensions:   3.75 X 6 X 0.13\u003c\/p\u003e","brand":"Tan Books | St. Benedict Press","offers":[{"title":"Default Title","offer_id":45091838525684,"sku":"9780895556417","price":4.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/19d7a19bcd6f463c5cb41c13fa9ad3815cadcb52.jpg?v=1714243162"},{"product_id":"doorsinthewallsoftheworldsignsoftranscendenceinthehumanstory-bypeterkreeft","title":"Doors in the Walls of the World: Signs of Transcendence in the Human Story - By: Peter Kreeft","description":"\u003cp\u003e\"There are more things in heaven and earth, Horatio, than are dreamt of in your philosophy.\"— Hamlet\u003c\/p\u003e\n\u003cp\u003eAfter William Shakespeare's Horatio sees the ghost of Hamlet's father, and scarcely believes his own eyes, Hamlet tells him that there is more to reality than he can know or imagine, including ghosts.\u003c\/p\u003e\n\u003cp\u003eHamlet's statement suggests that the walls of the material world, which we perceive with our senses and analyze with our intellects, have doors that open into the More beyond them. Philosopher Peter Kreeft explains in this book that the More includes \"The Absolute Good, Platonic Forms, God, gods, angels, spirits, ghosts, souls, Brahman, Rta (the Hindu ontological basis for cosmological karma), Nirvana, Tao, 'the will of Heaven', The Meaning of It All, Something that deserves a capital letter.\"\u003c\/p\u003e\n\u003cp\u003eWith razor-sharp reasoning and irrepressible joy, Kreeft helps us to find the doors in the walls of the world. Drawing on history, physical science, psychology, religion, philosophy, literature, and art, he invites us to welcome what lies on the other side so that we can begin living the life of Heaven in the here and now.\u003c\/p\u003e\n\u003cp\u003eFormat: Paperback\u003c\/p\u003e\n\u003cp\u003eISBN\/UPC: 9781621642282\u003c\/p\u003e","brand":"Ignatius Press","offers":[{"title":"Default Title","offer_id":45091838591220,"sku":"DWWP","price":15.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/f62cf5620061c2d613d781bf93865ea18bbd335f.jpg?v=1714243165"},{"product_id":"defending-marriage-twelve-arguments-for-sanity-by-anthony-esolen","title":"Defending Marriage  Twelve Arguments For Sanity By Anthony Esolen","description":"\u003cp\u003eDefending Marriage: Twelve Arguments for Sanity is a rousing, compelling defense of traditional, natural marriage.\u003cbr\u003eHere, Anthony Esolen-professor at Providence College and a prolific writer uses moral, theological, and cultural arguments to defend this holy and ancient institution, bedrock of society-and to illuminate the threats it faces from modern revolutions in law, public policy, and sexual morality.\u003cbr\u003eInside, discover:\u003c\/p\u003e\n\u003cp\u003e- Traditional marriage's roots in age-old religious, cultural, and natural laws\u003cbr\u003e- Why gay marriage is a metaphysical impossibility\u003cbr\u003e- How acceptance and legal sanction of gay marriage threatens the family\u003cbr\u003e- How the state becomes a religion when it attempts to elevate gay marriage, and enshrine as a civil right all consensual sex\u003cbr\u003e- How divorce and sexual license have brought marriage to the brink\u003cbr\u003e- How today's culture has impoverished and emptied love of its true meaning\u003c\/p\u003e\n\u003cp\u003eIn Defending Marriage, Esolen expertly and succinctly identifies the cultural dangers of gay marriage and the Sexual Revolution which paved its way.\u003cbr\u003eHe offers a stirring defense of true marriage, the family, culture, and love-and provides the compelling arguments that will return us to sanity, and out of our current morass.\u003c\/p\u003e","brand":"Tan Books | St. Benedict Press","offers":[{"title":"Default Title","offer_id":45091839607028,"sku":"97816189060450","price":14.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/s-l300.jpg?v=1714243199"},{"product_id":"primerlibrodelossantos","title":"Primer Libro de los Santos","description":"\u003cp\u003ePrimer Libro de los Santos Spanish\u003c\/p\u003e","brand":"Catholic Book Publishing","offers":[{"title":"Default Title","offer_id":45091839836404,"sku":"13322S","price":10.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/2630c45b137e66a651c5bcbe25d29c7cc37d25ac.jpg?v=1714243206"},{"product_id":"sign-of-her-heart-by-john-m-haffert","title":"Sign of Her Heart by John M. Haffert","description":null,"brand":"101 Foundation","offers":[{"title":"Default Title","offer_id":45091840098548,"sku":"1890137111","price":10.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/ddde2bf2e363d66c983a8c7c118df0cd4e7f0298.jpg?v=1714243216"},{"product_id":"saint-maximilian-kolbe-a-hero-of-the-holocaust","title":"Saint Maximilian Kolbe: A Hero of the Holocaust - by Fiorella De Maria","description":"\u003cp\u003eMaximilian Kolbe's decision to take the place of a condemned man in the Auschwitz concentration camp is one of the greatest stories of heroism to emerge from the Holocaust. This book brings to life for a younger audience the incredible story of a Polish weaver's son who grew up to be a priest, a missionary, and a martyr.\u003c\/p\u003e\n\u003cp\u003eKolbe lived amid the political unrest, the social change, and the spiritual battles that shaped the modern world. In the thick of it all, he had one goal—to share the love of God with as many people as possible. And he was a great innovator, spreading the Gospel through multimedia—a work that took him all the way to Nagasaki, Japan.\u003c\/p\u003e\n\u003cp\u003eWith his deep love for Our Lady, Kolbe also founded a Marian movement that has spread throughout the world, the Militia Immaculatae, also known as the Knights of the Immaculata. His imitation of Mary's tremendous trust in God enabled him to bring hope everywhere he went, including a prison camp.\u003c\/p\u003e\n\u003cdiv class=\"line-item-group\"\u003e\n\u003cdiv class=\"line-item-details format\"\u003eFormat:\u003cspan\u003e \u003c\/span\u003ePaperback\u003c\/div\u003e\n\u003cdiv class=\"line-item-details upc\"\u003eISBN\/UPC:\u003cspan\u003e \u003c\/span\u003e9781621643227\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"line-item-group\"\u003e\n\u003cdiv class=\"line-item-details depth\"\u003eLength:\u003cspan\u003e \u003c\/span\u003e0.5 (in)\u003c\/div\u003e\n\u003cdiv class=\"line-item-details size\"\u003eSize (HxW):\u003cspan\u003e \u003c\/span\u003e8 x 5.25 (in)\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"line-item-group\"\u003e\n\u003cdiv class=\"line-item-details publication\"\u003ePublication date:\u003cspan\u003e \u003c\/span\u003eAugust 04, 2022\u003c\/div\u003e\n\u003cdiv class=\"line-item-details productView-info-weight\"\u003eWeight:\u003cspan\u003e \u003c\/span\u003e8.85 oz\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cp\u003e \u003c\/p\u003e","brand":"Ignatius Press","offers":[{"title":"Default Title","offer_id":45091840360692,"sku":"STMKP","price":12.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/STMKP__62727-1658425190.jpg?v=1714243223"},{"product_id":"little-office-of-the-blessed-virgin-mary-by-john-e-rotelle-osa","title":"Little Office of the Blessed Virgin Mary - by John E. Rotelle, OSA","description":"\u003cp\u003eThe Little Office of the Blessed Virgin Mary contains the revised edition approved by the Sacred Congregation for Divine Worship and the United States Bishops’ Committee on the Liturgy. With readable type, this unique book contains a wealth of Marian themes and texts in a format patterned after the Liturgy of the Hours. Printed in two colors and bound in beautiful blue Dura-Lux, the Little Office of the Blessed Virgin Mary is an indispensable resource for all who wish to honor Mary in a way that harmonizes with the liturgy.\u003c\/p\u003e","brand":"Catholic Book Publishing","offers":[{"title":"Default Title","offer_id":45091840753908,"sku":"45019","price":24.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/450-19-1.jpg?v=1714243234"},{"product_id":"spiritual-diary-monthly-meditations-on-twelve-virtues","title":"Spiritual Diary: Monthly Meditations on Twelve Virtues","description":"\u003cp\u003eIntroduction\u003c\/p\u003e\n\u003cp\u003eAnonymously published in 1775, this book swept through the Catholic world and multiple editions were published in quick succession. It remained readily available to generations of Catholics in many languages. The author remains unknown to this day. In a brief preface to the 4th edition of 1778 the following advice was given:\u003cbr\u003e“To draw the utmost profit from this volume, mere reading will not suffice. It must be read with calm reflection, deep thought, and ardent desire to translate into action whatever is found to be beneficial to the individual soul.”\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003eWithout a doubt, the Spiritual Diary is one of the most widely read works in ascetical literature. Over the centuries, countless souls have drawn part of their spiritual formation from meditation upon the saintly advice contained in these pages. Its collections of sayings and examples of saints provides a source of meditation for numerous devout souls.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003eThe meditations are arranged for the calendar year with one of twelves virtues for each month. Perfection, Humility, Mortification, Patience, Meekness, Obedience, Simplicity, Diligence, Prayer, Confidence, Charity and Union are the virtues chosen, and under each virtue are gathered pertinent sayings and examples of the saints for every day of the month. A thought may be read daily, or the reader may prefer to read the different sections according to his spiritual needs.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003eMany have guessed that the writer was a devoteé of St. Alphonsus because of the pattern of the meditations and the numerous direct quotes from his writings. But other spiritual writers widely quoted are: St. Mary Magdalen diPazzi, St. Francis deSales, St. Vincent dePaul, and St. Theresa of Avila.\u003c\/p\u003e\n\u003cp\u003e\u003cbr\u003eWhoever compiled this treasure house of advice has earned the lasting gratitude of Loreto’s editor who has used this book almost daily for over forty years. Since it has not been readily available to the general public since the last known edition from 1962, we have decided to issue this modern edition in the hopes that a new generation of 21st century Catholics may find as much spiritual benefit herein, as this editor has.\u003c\/p\u003e","brand":"Loreto Publications","offers":[{"title":"Default Title","offer_id":45091841999092,"sku":"SPD","price":19.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/Spiritual-Diary-Mockup_xwlw-5x--1.jpg?v=1714243270"},{"product_id":"maria-von-trapp-and-her-musical-family-by-cheri-blomquist","title":"Maria von Trapp: and Her Musical Family - by Cheri Blomquist","description":"\u003cp\u003eSince its world premiere in 1959, the Broadway hit (and movie) musical The Sound of Music has captivated millions of people around the world. Almost everyone knows of the aristocratic von Trapp family, the young postulant Maria who brought music back into their lives, and their harrowing escape from Hitler’s evil Third Reich. But few know the incredible true story behind the musical.\u003c\/p\u003e\n\u003cp\u003eIn this new Vision Book, that dramatic story is at last told for young readers, based on Maria's bestselling autobiographies and Agathe von Trapp's memoir. Part epic adventure and part spiritual testimony to God's constant faithfulness, this story of the family that became one of the most beloved choirs in history is a page-turner to the very end.\u003c\/p\u003e\n\u003cp\u003eTrusting in God at every difficult step, the von Trapps gradually rose to world-wide fame, finding their place in America and eventually a new identity as American citizens. The harrowing story of their many adventures and ultimate glorious success is one you will never forget!\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eProduct Details\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eProduct Code: MVTP\u003c\/p\u003e\n\u003cp\u003eFormat: Paperback\u003c\/p\u003e\n\u003cp\u003eISBN\/UPC: 9781621643685\u003c\/p\u003e\n\u003cp\u003eLength: 0.75 (in)\u003c\/p\u003e\n\u003cp\u003eSize (HxW): 8 x 5.25 (in)\u003c\/p\u003e\n\u003cp\u003ePages: 291\u003c\/p\u003e\n\u003cp\u003ePublication Date: Invalid date\u003c\/p\u003e\n\u003cp\u003eWeight: 10.32 oz\u003c\/p\u003e","brand":"Ignatius Press","offers":[{"title":"Default Title","offer_id":45091842031860,"sku":"9781621643685","price":12.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/MVTP_r__56849-1633034419.jpg?v=1714243273"},{"product_id":"confirmationbook-stjoseph","title":"Confirmation Book - St. Joseph Edition By Fr. Lovasik","description":"\u003cp\u003eThe Saint Joseph Confirmation Book is an ideal companion for Confirmation candidates, providing the Confirmation rite, prayers, instructions, and inspiring readings from the Gospel. This comprehensive book, with an elegantly embossed red hard cover, makes a perfect resource and gift for those preparing for the Sacrament of Confirmation. This book has been updated in accord with the Roman Missal. Available in hardback or Dura-Lux binding, and it can be personalized.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","brand":"Catholic Book Publishing","offers":[{"title":"Hardback","offer_id":45091842097396,"sku":"24904","price":13.95,"currency_code":"USD","in_stock":false},{"title":"Imitation Leather","offer_id":45091842130164,"sku":"24919","price":17.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/9b9a7e3c66c1cbbd43ceaa1cd841528386fa42e2.jpg?v=1714243276"},{"product_id":"unainvitacinparaorarenfamiliacreciendounidoscadadaenlafeyelamor-bydominicansistersofsaintceciliacongregration","title":"Una invitación para ORAR EN FAMILIA: Creciendo unidos cada día en la fe y el amor - by: Dominican Sisters of Saint Cecilia Congregration","description":"\u003cp\u003e135 full-color images! Enter the mystery of prayer and glorify God as a family.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003ePraying together not only enriches family life but also leads the Catholic family toward its primary goal: the holiness and salvation of each member. \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eThis wonderful little book provides a simple and easy-to-implement plan for family prayer. Arranged successively according to the basic stages of prayer, A Short Guide to Praying as a Family allows each family to progress step by step from one level of prayer to the next. Beautiful stained-glass images invite you to enter the mystery of each prayer and give glory to God as a family.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eDesigned to be used throughout the day, this book will help your family speak to God, turn to Him for help, listen to Him, and praise Him. What better gift could you give them?\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eCompiled by The Dominican Sisters of St. Cecilia in Nashville, this little book is backed by a strong Catholic tradition rooted in teaching the faith. From making time to recite basic oral prayers throughout the day to making each moment of life a prayer, A Short Guide to Praying as a Family is a lifelong guide to the spiritual life and a powerful means to building a relationship with the Lord.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eEste hermoso libro, escrito por las Hermanas Dominicas de la Congregación de Sta. Cecilia con la colaboración del diácono Rafael y Ana Bougrat, Ricardo y Carolina Catalán, y Diana Catalán, proporciona un plan simple y fácil de implementar para la oración en familia. Ordenado de manera sucesiva según las etapas básicas de la oración, Una Invitación para Orar en Familia, le permite a cada familia progresar paso a paso de un nivel de oración al siguiente. Con el prólogo por el arzobispo Charles J. Chaput, el libro contiene todas las secciones de la edición en inglés, más secciones añadidas de algunas tradiciones hispanas, tales como las Posadas, la celebración de quince años, la presentación de los tres años, los novenarios, etc. Contiene imágenes de vitrales e incluye 20 cuadros originales del estilo Cusqueño, por la Sra. Clorinda Galdos Bell, nativa de Cuzco, Perú. 210 páginas, 150 imágenes a color, tapa blanda.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eABOUT THE AUTHORS\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eTHE DOMINICAN SISTERS OF ST. CECILIA (THE NASHVILLE DOMINICANS)\u003c\/p\u003e\n\u003cp\u003eEight centuries ago, St. Dominic de Guzman, inspired by the Holy Spirit in response to the needs of his time, founded an Order with the mission of preaching for the salvation of souls. Dominic’s love for God and neighbor continues to inspire the Dominican Sisters of St. Cecilia Congregation today, as they joyfully embrace the Church’s call to the new evangelization. Founded in 1860 in Nashville, Tennessee, the Sisters live a contemplative-apostolic life of community, study, and apostolic service in a monastic framework that fosters contemplation. Through the apostolate of teaching, the Sisters have the privilege of serving students and families in the United States, Canada, Australia, Italy, Scotland, and the Netherlands. Under the protection and guidance of the Blessed Virgin Mary, the Sisters seek to live in fidelity to the Church and to bring others to Christ.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eABOUT THE PHOTOGRAPHER\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eFATHER LAWRENCE LEW, O.P.\u003c\/p\u003e\n\u003cp\u003eA Dominican priest of the Province of England, Father Lawrence shares his love for beauty, and his talent for capturing it, through thousands of photographs of sacred art and architecture, of people, and of nature. Father Lawrence reflects, “I find that, as Hopkins said, ‘the world is charged with the grandeur of God,’ and so my photos might be likened to an offering of thanks to God for the goodness I see around me.” His gift for photography is becoming more and more widely recognized. We are very grateful to Father Lawrence for his generosity in providing the stunning photographs of stained glass contained in this book.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eItem No:   SB6892\u003c\/p\u003e\n\u003cp\u003ePages:   209\u003c\/p\u003e\n\u003cp\u003eISBN:   9781618906892\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003ePublication Date:   2015\u003c\/p\u003e\n\u003cp\u003eBinding:   Paperbound\u003c\/p\u003e\n\u003cp\u003eDimensions:   8.25\" X 8.25\"\u003c\/p\u003e","brand":"Tan Books | St. Benedict Press","offers":[{"title":"Default Title","offer_id":45091842621684,"sku":"9781618906892","price":19.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/9593990611e676fc6f121c2574cb5b4f0fb69f95.jpg?v=1714243291"},{"product_id":"my-meditations-on-saint-paul-by-rev-james-e-sullivan-ms","title":"My Meditations On Saint Paul By Rev. James E. Sullivan, M.S.","description":"\u003cp\u003eFather James Sullivan begins each daily devotional with a scene from Acts of the Apostles or the Epistles of Saint Paul. Filled with rich historical and personal details describing the thoughts and feelings that a disciple must have experienced, Sullivan places you in the midst of the early Christians who heard the words of Saint Paul.\u003c\/p\u003e\n\u003cp\u003eThis pocket-sized devotional gives you everything you need to walk with and learn at the feet of the Saint Paul, including:\u003c\/p\u003e\n\u003cp\u003e• Intimate, personal reflections on the words and acts of Saint Paul \u003c\/p\u003e\n\u003cp\u003e• Heartfelt prayers, echoing the same prayers and petitions of the great convert and evangelizer\u003c\/p\u003e\n\u003cp\u003e• Detailed maps chronicling Saint Paul's extensive missionary journeys (p. 557-560)\u003c\/p\u003e\n\u003cp\u003e• A timeline of St. Paul's life both before and after his dramatic conversion (p. 563-564)\u003c\/p\u003e\n\u003cp\u003e• And much more...\u003c\/p\u003e\n\u003cp\u003eAfter Christ's death and resurrection, Paul became the first Apostle to preach His Good News to non-Jews (Gentiles). This is generally considered the most decisive moment in Church history and Saint Paul was at the center of that moment. \u003c\/p\u003e\n\u003cp\u003eNow, you can travel with Saint Paul on his missionary tours, learn at his feet, and discover how to bring the teachings of Christ to your world.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","brand":"Confraternity of the Precious Blood","offers":[{"title":"Default Title","offer_id":45091842752756,"sku":"9781618908278","price":11.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/content.jpg?v=1714243294"},{"product_id":"deliverance-prayers-for-use-by-the-laity-by-fr-chad-ripperger","title":"Deliverance Prayers: For Use by the Laity - by Fr. Chad Ripperger (English or Spanish)","description":"\u003cp\u003ePrayers for use by the laity in waging spiritual warfare from the public domain and the Church’s treasury. \u003cbr\u003eThis book has an imprimatur from the Archdiocese of Denver.\u003c\/p\u003e\n\u003cp\u003eWEIGHT: 5 OZ\u003cbr\u003eDIMENSIONS: 5 × 0.31 × 8 IN\u003cbr\u003eFORMAT: PAPERBACK\u003cbr\u003ePAGES: 135\u003cbr\u003e\u003cbr\u003e\u003cstrong\u003eSpanish\/Espanol:\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003eOraciones para que los laicos las utilicen en la guerra espiritual desde el dominio público y el tesoro de la Iglesia. El libro tiene un imprimatur de la Arquidiócesis de Denver.\u003c\/p\u003e\n\u003cp\u003eWEIGHT:    6.6 OZ\u003cbr\u003eDIMENSIONS:    5 × 0.42 × 8 IN\u003cbr\u003ePAGES: 166\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","brand":"Sensus Traditions Press","offers":[{"title":"English","offer_id":45091844194548,"sku":"DPLENP","price":17.95,"currency_code":"USD","in_stock":false},{"title":"Spanish","offer_id":45091844227316,"sku":"DPLESP5","price":15.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/61jLcNyGeoL.jpg?v=1714243335"},{"product_id":"saint-pius-x-the-farm-boy-who-became-pope-by-walter-diethelm-osb","title":"Saint Pius X The Farm Boy Who Became Pope by Walter Diethelm, O.S.B.","description":"\u003cp\u003eIllustrated\u003cbr\u003eAnother stirring tale from the Vision Books series for youth 9-15 years, this book tells the charming story of Giuseppe Sarto, \"the farm boy who became Pope\". Young readers will be inspired by the life of this holy man--from his youthful days of hard work and prayer to receive the education he needed; to his years as country priest, encouraging his people to holiness; through the steady promotions to pastor, monsignor, bishop, cardinal, and archbishop, which he reluctantly accepted but in which he always became the beloved of those he served; to his days as the Holy Pontiff, Pope Pius X, the only canonized Pope of this century. This simple man who never forgot the poor will always be a timely example of holiness.\u003c\/p\u003e\n\u003cp\u003eBorn of very humble circumstances, young Giuseppe Sarto had one burning desire while growing up on a farm--to become a priest. But never did he or his generous parents ever dream that he would one day sit in the Chair of St. Peter. This is the inspiring story of the humble \"Pope of little children,\" whose love for Christ and children moved him to change the requirements for First Communion so that young children as early as 7 years old could receive the Holy Eucharist.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","brand":"Ignatius Press","offers":[{"title":"Default Title","offer_id":45091844423924,"sku":"SPXP","price":12.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/SPXP_r__68385-1617024494.jpg?v=1714243341"},{"product_id":"consolingtheheartofjesusadoityourselfretreat","title":"Consoling the Heart of Jesus: A do it yourself retreat - by Michael E. Gaitley, MIC","description":"\u003cp\u003eMy intention in writing this guide is to lead you through the simple steps of running the retreat. For those who have already led the 33 Days to Morning Glory Group Retreat, I'll be introducing you to some changes with this CHJ retreat.  Gaitley, Michael\u003c\/p\u003e","brand":"Marians of the Immaculate Conception: National Shrine of The Divine Mercy | Association of Marian Helpers | Marian Press","offers":[{"title":"Default Title","offer_id":45091845832948,"sku":"CHJ","price":16.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/8b38074949ca4e61d93bf49f8dacb98027198fe6.jpg?v=1714243386"},{"product_id":"theologyofthebodyforbeginners-3","title":"Theology of the Body for Beginners: Revised Edition - by Christopher West","description":"\u003cp class=\"author\"\u003eAvailable new or used (only 1 available, First Edition 2004).\u003c\/p\u003e\n\u003cp class=\"author\"\u003eBroken families, abortion, AIDS, internet pornography, sexual abuse scandals, homosexual marriage; our Church and our world are in the midst of a profound sexual crisis. Is there a way out?\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eFor such a time as this have we been given St. John Paul II’s Theology of the Body. Based on the words of Jesus, St. John Paul II’s famous reflections on the body and sex take us to the root of the modern crisis and chart the path to an authentic sexual liberation. Yet the saint’s dense scholarship often intimidates the average person.\u003c\/p\u003e\n\u003cp\u003eIn his previous book,\u003cspan\u003e \u003c\/span\u003e\u003cem\u003eTheology of the Body Explained\u003c\/em\u003e, Christopher West offered a more detailed, six-hundred-page commentary on St. John Paul II’s Theology of the Body.\u003c\/p\u003e\n\u003cp\u003e\u003cb\u003eHere, he provides a short and popular summary of the saint’s revolutionary teaching while answering big questions like:\u003c\/b\u003e\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003eWhat is the meaning of life?\u003c\/li\u003e\n\u003cli\u003eWhy did God create us male and female?\u003c\/li\u003e\n\u003cli\u003eWhy is there evil in the world and how do we overcome it?\u003c\/li\u003e\n\u003cli\u003eHow do we attain true happiness on earth?\u003c\/li\u003e\n\u003cli\u003eWhat kind of joys await us in heaven?\u003c\/li\u003e\n\u003cli\u003eHow can we experience the love we long for in the depth of our hearts?\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003eThe first edition of\u003cspan\u003e \u003c\/span\u003e\u003cem\u003eTheology of the Body for Beginners\u003c\/em\u003e\u003cspan\u003e \u003c\/span\u003e(2004) quickly became an international best-seller. This freshly revised and expanded edition is based on Dr. Michael Waldstein’s much improved translation of St. John Paul II’s catechesis.\u003c\/p\u003e\n\u003cp\u003e\u003cb\u003eNew for this edition:\u003c\/b\u003e\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003eAll quotations have been updated with the new translation.\u003c\/li\u003e\n\u003cli\u003eKey insights discovered through Dr. Waldstein’s access to the St. John Paul II archives have been incorporated.\u003c\/li\u003e\n\u003cli\u003eThe outline of the text has been substantially reorganized to reflect the newly discovered outline of St. John Paul II’s original manuscript.\u003c\/li\u003e\n\u003cli\u003eSt. John Paul II’s “hidden” and previously untranslated addresses are summarized.\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003ch4\u003e\u003cbr\u003e\u003c\/h4\u003e\n\u003cdiv class=\"column-1\"\u003e\n\u003cdiv\u003e\u003cspan\u003eFormat: Paperback\u003c\/span\u003e\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan\u003eISBN: \u003c\/span\u003e9781934217856\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan\u003eWeight: \u003c\/span\u003e0.5 lb\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan\u003eDimensions: \u003c\/span\u003eL: 8.5, W: 5.5, D: 0.507\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan\u003ePage Count: \u003c\/span\u003e168\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan\u003eEcclesiastical Designation:\u003c\/span\u003e\u003cspan\u003e \u003c\/span\u003eImprimatur\u003c\/div\u003e\n\u003c\/div\u003e\n\u003cdiv class=\"column-2\"\u003e\n\u003cdiv\u003e\n\u003cspan\u003ePublication Date: \u003c\/span\u003eSep 01, 2009\u003c\/div\u003e\n\u003cdiv\u003e\n\u003cspan\u003eAuthor(s):\u003c\/span\u003e\u003cspan\u003e \u003c\/span\u003eChristopher West\u003c\/div\u003e\n\u003cdiv\u003e\u003cbr\u003e\u003c\/div\u003e\n\u003cdiv\u003eUsed paperback - 2004 first edition\u003c\/div\u003e\n\u003c\/div\u003e","brand":"Ascension Press","offers":[{"title":"New","offer_id":47646823743732,"sku":"9781934217856","price":16.99,"currency_code":"USD","in_stock":false},{"title":"Used","offer_id":47646823776500,"sku":"1932645349","price":10.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/TOB_Beginners_3D.webp?v=1745268096"},{"product_id":"atreasuryofwisdomthewordsofjesus","title":"A Treasury of Wisdom The words of Jesus","description":"\u003cp\u003e\u003cspan style=\"color: #333333; font-family: Tahoma, Verdana, Segoe, sans-serif; font-size: medium;\"\u003eLocation: BK--\u003c\/span\u003e\u003c\/p\u003e\r\n\u003cp\u003e\u003cspan style=\"color: #333333; font-family: Tahoma, Verdana, Segoe, sans-serif; font-size: medium;\"\u003eThe words of Jesus of Nazareth continue to amaze, confound and inspire listeners as they did two thousand years ago. They resonate down the centuries, poetic in their simplicity, challenging in their meaning, uncompromising in their authority. Whether Jesus was describing the kingdom of Heaven, stripping away worn-out conventions or defining love and forgiveness, he chose direct, down-to-earth language for the new age he heralded, clothing his stories in imagery from the everyday world. Here, retold in the words of the Revised Standard Version Bible, are some of the most memorable sayings of Jesus recorded in the Gospels of his disciples Matthew, Mark, Luke and John. They range from frank, compassionate advice to devastating reprimands; from new interpretations of ancient law to chilling prophecies; from the parables of the Good Samaritan and the Vineyard to the two great prose poems from his Sermon on the Mount – the Lord’s Prayer and the Beatitudes. Illuminating Jesus’ words are over 40 paintings by celebrated artists such as Raphael, Masaccio, Piero della Francesca, Caravaggio, Fra Angelico, Poussin and Millet. In this beautiful hardcover keepsake with a silk ribbon marker, the words and paintings combine to create a treasury that will appeal not only to Christian but to everyone searching for spiritual truth.\u003c\/span\u003e\u003c\/p\u003e","brand":"Ignatius Press","offers":[{"title":"Default Title","offer_id":45091846750452,"sku":"0898709121","price":17.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/7edbf8db5f19f368b44df53ef2bdf543664073ba.jpg?v=1714243409"},{"product_id":"thestoryofeaster","title":"The Story of Easter by George Brundage","description":"\u003cp\u003eST. JOSEPH \"CARRY-ME-ALONG\" BOARD BOOK\u003c\/p\u003e\n\u003cp\u003ePages: 16\u003c\/p\u003e\n\u003cp\u003eAuthor: GEORGE BRUNDAGE\u003c\/p\u003e\n\u003cp\u003eSize: 6 x 8 1\/2\u003c\/p\u003e\n\u003cp\u003eColor: ILLUSTRATED\u003c\/p\u003e\n\u003cp\u003eBinding: BOARD\u003c\/p\u003e","brand":"Catholic Book Publishing","offers":[{"title":"Default Title","offer_id":45091846979828,"sku":"84822","price":7.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/5c4bd05e7ec1f16da7fe66e664bb8720b154bfd8.jpg?v=1714243414"},{"product_id":"theblessingcup","title":"The Blessing Cup - Prayer Rituals For Families And Groups By Rock Travnikar, O.F.M.","description":"\u003cp\u003e\u003cspan\u003eRitual is a powerful binding force. From the bedtime routines that toddlers insist upon to the comic routines that leave outsiders puzzled, all groups, including families, shape their identities by the rites they observe. And, in the process, they discover that something holy lies at the heart of their relationships.\u003c\/span\u003e\u003c\/p\u003e","brand":"Franciscan Media","offers":[{"title":"Default Title","offer_id":45091847012596,"sku":"9781616364915","price":10.99,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/364915.jpg?v=1714243416"},{"product_id":"jesuschristbeforehebecameasuperstar","title":"Jesus Christ before He became a superstar","description":"Fitzpatrick, James K","brand":"Roman Catholic Books","offers":[{"title":"Default Title","offer_id":45091847373044,"sku":"912141018","price":11.95,"currency_code":"USD","in_stock":true}]},{"product_id":"miraclesdohappengodcandotheimpossible","title":"USED - Miracles Do Happen: God can do the impossible - by Sr. Breige McKenna","description":"\u003cp\u003eDo you believe in miracles? Sister Briege McKenna does. For over 25 years, since she was healed of crippling arthritis, Sister Briege has ministered hope and healing to countless people all over the world, from huge rallies in Latin America to retreats in Korea. Miracles Do Happen tells the story of Sister Briege's encounter with the healing power of God. It also shares her insights about faith, the power of the Eucharist and the importance of prayer. Most of all, it points the way to a closer relationship with Jesus, greater knowledge of his love, and deeper faith in his power to do the impossible.\u003c\/p\u003e\n\u003c!----\u003e","brand":"Servant Books","offers":[{"title":"Default Title","offer_id":46981090640116,"sku":"9780892833160","price":12.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/61qG0OIGfVL._SY466.jpg?v=1722696222"},{"product_id":"marryheranddieforher","title":"Marry Her and Die for Her By Costanza Miriano","description":"Advice on how to be a real man, a good father, \u0026amp; a courageous leader by laying down your life for the woman you love Miriano, Costanza","brand":"Tan Books | St. Benedict Press","offers":[{"title":"Default Title","offer_id":45091847733492,"sku":"9781618906946","price":24.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/images--3.jpg?v=1714243428"},{"product_id":"humilitywellspringofvirtue","title":"Humility: wellspring of virtue by Dietrich Von Hildebrand","description":null,"brand":"Sophia Institute Press","offers":[{"title":"Default Title","offer_id":45091847962868,"sku":"9780918477590","price":5.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/d4580da6fde1b54472444c488b6817d8603f7262.jpg?v=1714243431"},{"product_id":"howcanigettoheaventhebiblesteachingonsalvationmadeeasytounderstand","title":"How can I get to Heaven, the bible's teaching on salvation made easy to understand","description":"Sungenis, Robert A.","brand":"Queenship","offers":[{"title":"Default Title","offer_id":45091848061172,"sku":"9781579180072","price":10.0,"currency_code":"USD","in_stock":true}]},{"product_id":"thesecretofmary","title":"The Secret of Mary - by St. Louis de Montfort","description":"\u003cp\u003eThe Secret of Mary is a classic Catholic devotional by St. Louis de Montfort that outlines the spiritual path to holiness through true devotion to the Blessed Virgin Mary, rooted in the Church’s tradition of Marian piety and sanctification. In concise, pointed reflections the author explains how a soul may cooperate with God’s grace through Mary’s maternal guidance, fostering deeper union with Christ and growth in virtue and love.([turn0search1]\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003eConcise guide to Marian devotion that complements the Church’s teaching on holiness and consecration\u003c\/li\u003e\n\u003cli\u003eDraws on the spirituality of St. Louis de Montfort, a renowned master of Marian theology\u003c\/li\u003e\n\u003cli\u003eExplains the interior practice of entrusting oneself to Mary to grow closer to Christ\u003c\/li\u003e\n\u003cli\u003eAccessible paperbound format suitable for both new and seasoned devotional readers\u003c\/li\u003e\n\u003cli\u003eHas inspired Popes and saints as a practical means toward greater consecration and sanctity\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cdiv\u003e\n\u003cp\u003eAuthor: St. Louis de Montfort\u003cbr\u003ePages:112\u003cbr\u003ePublication Date: 5\/1\/1998\u003cbr\u003eProduct Format: Paperbound\u003cbr\u003eHeight: 6.00\u003cbr\u003eWidth: 3.75\u003c\/p\u003e\n\u003c\/div\u003e\n\u003cp\u003e\u003cbr\u003e \u003c\/p\u003e","brand":"Tan Books | St. Benedict Press","offers":[{"title":"Default Title","offer_id":45091848126708,"sku":"1543","price":9.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/1659218f49b463aa30f483768a8da72c34288f9e.jpg?v=1714243437"},{"product_id":"thestoryofasoul","title":"The Story of a Soul: The Autobiography of the Little Flower - by St. Thérèse of Lisieux","description":"\u003cp\u003e\u003cspan face=\"roboto_slabregular, Arial, Helvetica, sans-serif\" style=\"font-family: roboto_slabregular, Arial, Helvetica, sans-serif;\"\u003e\u003cspan style=\"font-size: 12px;\"\u003eThe Story of a Soul conveys St. Thérèse of Liseux's \"Little Way\" of spiritual childhood - her \"elevator\" to Heaven, as she called it. This method was approved by Pope Pius XI as a way for all to grow in holiness through unfailing confidence and childlike delight in God's merciful love.\u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan face=\"roboto_slabregular, Arial, Helvetica, sans-serif\" style=\"font-family: roboto_slabregular, Arial, Helvetica, sans-serif;\"\u003e\u003cspan style=\"font-size: 12px;\"\u003eAgain and again in this book, St. Thérèse shows us how her \"Little Way\" of love and trust comes straight from Sacred Scripture. \u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan face=\"roboto_slabregular, Arial, Helvetica, sans-serif\" style=\"font-family: roboto_slabregular, Arial, Helvetica, sans-serif;\"\u003e\u003cspan style=\"font-size: 12px;\"\u003eThis book belongs in every Catholic home, for Pope St Pius X called St. Thérèse of Liseux the \"greatest Saint of modern times.\"\u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e\u003cspan style=\"font-size: 12px;\"\u003e\u003cstrong\u003e\u003cspan face=\"roboto_slabregular, Arial, Helvetica, sans-serif\" style=\"font-family: roboto_slabregular, Arial, Helvetica, sans-serif;\"\u003eAbout the Author\u003cbr\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan face=\"roboto_slabregular, Arial, Helvetica, sans-serif\" style=\"font-family: roboto_slabregular, Arial, Helvetica, sans-serif;\"\u003e\u003cspan style=\"font-size: 12px;\"\u003eSt. Thérèse of Lisieux, also known as \"Thérèse of the Child Jesus\" and \"The Little Flower\", was the last of nine children born to Louis and Zelie Martin, at France in 1873. She was often anxious and depressed in childhood, as she suffered the early death of her mother. After she converted interiorly and began to read Thomas à Kempis' The Imitation of Christ, she joined 2 of her sisters in a discalced Carmelite convent as a nun at just 15 years old. After her oldest sister was elected prioress, Thérèse became a permanent novice to allay suspicions that her family was dominating the small community. She lived humbly, concealing her intense prayer life and countless sacrifices \u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan face=\"roboto_slabregular, Arial, Helvetica, sans-serif\" style=\"font-family: roboto_slabregular, Arial, Helvetica, sans-serif;\"\u003e\u003cspan style=\"font-size: 12px;\"\u003eThérèse is the author of her own popular autobiography entitled The Story of a Soul, which she began writing in 1895, and she instituted a simple path to holiness now widely known as the \"Little Way\". She died of tuberculosis on September 30, 1897, at the age of 24 and was canonized only 28 years later, in 1925, by Pope Pius XI. She was later installed as the thirty-third Doctor of the Church by Pope John Paul II in 1997.\u003cbr\u003e\u003cbr\u003e\u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan face=\"roboto_slabregular, Arial, Helvetica, sans-serif\" style=\"font-family: roboto_slabregular, Arial, Helvetica, sans-serif;\"\u003e\u003cspan style=\"font-size: 12px;\"\u003eItem No:   TC1384\u003cbr\u003e\u003c\/span\u003e\u003c\/span\u003e\u003cspan face=\"roboto_slabregular, Arial, Helvetica, sans-serif\" style=\"font-family: roboto_slabregular, Arial, Helvetica, sans-serif;\"\u003e\u003cspan style=\"font-size: 12px;\"\u003ePages:   192\u003cbr\u003e\u003c\/span\u003e\u003c\/span\u003e\u003cspan face=\"roboto_slabregular, Arial, Helvetica, sans-serif\" style=\"font-family: roboto_slabregular, Arial, Helvetica, sans-serif;\"\u003e\u003cspan style=\"font-size: 12px;\"\u003eISBN:   9780895551559\u003cbr\u003e\u003c\/span\u003e\u003c\/span\u003e\u003cspan face=\"roboto_slabregular, Arial, Helvetica, sans-serif\" style=\"font-family: roboto_slabregular, Arial, Helvetica, sans-serif;\"\u003e\u003cspan style=\"font-size: 12px;\"\u003ePublication Date:   2010\u003cbr\u003e\u003c\/span\u003e\u003c\/span\u003e\u003cspan face=\"roboto_slabregular, Arial, Helvetica, sans-serif\" style=\"font-family: roboto_slabregular, Arial, Helvetica, sans-serif;\"\u003e\u003cspan style=\"font-size: 12px;\"\u003eBinding:   Paperbound\u003cbr\u003e\u003c\/span\u003e\u003c\/span\u003e\u003cspan face=\"roboto_slabregular, Arial, Helvetica, sans-serif\" style=\"font-family: roboto_slabregular, Arial, Helvetica, sans-serif;\"\u003e\u003cspan style=\"font-size: 12px;\"\u003eDimensions:   5.5\" X 8.5\" X 0.5\"\u003c\/span\u003e\u003c\/span\u003e\u003c\/p\u003e","brand":"Tan Books | St. Benedict Press","offers":[{"title":"Default Title","offer_id":45091848388852,"sku":"TC1384","price":19.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/5ac514d92490f0ebb39f72ea2bd60b9a39f2d96c.jpg?v=1714243439"},{"product_id":"theliferevelationsofannecatherineemmerich","title":"The Life \u0026 Revelations of Anne Catherine Emmerich - by Fr. Carl E. Schmoger (2 Volumes)","description":"\u003cblockquote\u003e\n\u003cp\u003eBeatified in 2004 by Saint John Paul II, Blessed Anne Catherine Emmerich stands as a staunch sign of contradiction to the modern world's misguided rationalism and disbelief. She lived at a time when the Church was under complete temporal assault, with impiety on the rise and political losses abounding, all of which made her life of suffering, piety, and special graces all the more potent.\u003c\/p\u003e\n\u003c\/blockquote\u003e\n\u003cp\u003eRecorded by Fr. Carl E. Schmoeger in the latter half of the 1800s,\u003cspan\u003e \u003c\/span\u003e\u003cstrong\u003e\u003cem\u003eThe Life and Revelations of Anne Catherine Emmerich\u003cspan\u003e \u003c\/span\u003e\u003c\/em\u003e\u003c\/strong\u003eshows the virtues of this pious nun, which far exceed the visions, revelations, and stigmata she received. Here is the story of a classically holy Bride of Christ: she was sickly, zealous, and extremely charitable; she lacked any self-interest, which made it all the more difficult for her when her visions and supernatural sufferings became public knowledge. Her divine favors, wondrously recounted in this biography, included visions of the lives of Our Lord and Our Lady, as well as the stigmata and other wounds of grace.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003e \u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eAs the cause for her beatification noted, however, what was most of value in her life was not these unusual graces, but her personal sanctity. Her humility, piety, and faithful love of Our Lord and Our Lady cannot be but the true marks of sanctity, more than any wounds in her hands or feet. Let these be the elements of Anne Catherine Emmerich's catechesis to you; let her show you how you too can love and long for the company of Jesus and Mary as she did.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003e \u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eNote: This Book comes in \u003cstrong\u003e2 volumes\u003c\/strong\u003e\u003cem\u003e\u003cspan\u003e \u003c\/span\u003eof\u003cspan\u003e \u003c\/span\u003e\u003cstrong\u003eThe Life and Revelations of Anne Catherine Emmerich\u003c\/strong\u003e\u003c\/em\u003e.\u003c\/p\u003e","brand":"Tan Books | St. Benedict Press","offers":[{"title":"Volume 1","offer_id":45091848421620,"sku":"9780895550590","price":26.0,"currency_code":"USD","in_stock":true},{"title":"Volume 2","offer_id":45091848454388,"sku":"9780895550606","price":26.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/9109__07094.jpg?v=1714243442"},{"product_id":"surprisedbytruth","title":"Surprised by Truth by Patrick Madrid","description":"\u003cp\u003e11 Converts give the biblical \u0026amp; historical reasons for becoming Catholic Madrid, Patrick\u003c\/p\u003e","brand":"Tan Books | St. Benedict Press","offers":[{"title":"Default Title","offer_id":45091848487156,"sku":"9780964261082","price":13.99,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/1081.jpg?v=1714243444"},{"product_id":"padrepiothetruestory","title":"No longer carrying due to publisher prices   Padre Pio The True Story","description":"","brand":"Our Sunday Visitor","offers":[{"title":"Default Title","offer_id":45091849601268,"sku":"9780879736736","price":27.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/293f0b03fba16e4e70b87689ccb556d5dba29480.jpg?v=1714243460"},{"product_id":"stpatricknovenaprayers","title":"St. Patrick Novena \u0026 Prayers","description":"\u003cp\u003eSaint Patrick Novena and Prayer Book.\u003cbr\u003eBeautifully Illustrated Prayer and Devotion Novena Book\u003cbr\u003eFeatures 24 pages of Prayers and Fratelli Bonella artwork.\u003cbr\u003eBook size: 3 3\/4\" x 6\".\u003c\/p\u003e","brand":"Hirten","offers":[{"title":"Default Title","offer_id":45091849666804,"sku":"2432640","price":4.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/0b9957de561b40499ee89ce65ffdcfb1bc4ac8df.jpg?v=1714243463"},{"product_id":"themassforchildren","title":"The Mass for Children By Rev. Jude Winkler, OFM","description":"\u003cp\u003e\u003cspan\u003e \u003c\/span\u003eintroduces the Mass to Catholic children. These are some of the features of this book:\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003ean introductory explanation of the Mass, a gift from Jesus\u003c\/li\u003e\n\u003cli\u003eexcerpts from the English translation of the \u003ci\u003eRoman Missal\u003c\/i\u003e\n\u003c\/li\u003e\n\u003cli\u003evibrant full-color illustrations\u003c\/li\u003e\n\u003cli\u003edurable sewn paperback binding\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e \u003c\/p\u003e","brand":"Catholic Book Publishing","offers":[{"title":"Default Title","offer_id":45091852583156,"sku":"489","price":2.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/489-1.jpg?v=1714243509"},{"product_id":"prayersforeveryday","title":"Prayers for Everyday - Children's Catholic Prayer Book","description":"\u003cp\u003eThis book by beloved author Rev. Lawrence G. Lovasik, S.V.D., contains simple prayers for Catholic children. These are some of the features of this book:\u003c\/p\u003e\n\u003cp\u003e  a prayer for day of the seven days of the week\u003cbr\u003e  a morning prayer and an afternoon prayer\u003cbr\u003e  a collection of thanksgiving prayers\u003cbr\u003e  full-color illustrations\u003cbr\u003e  durably sewn paperback binding\u003c\/p\u003e\n\u003c!----\u003e","brand":"Catholic Book Publishing","offers":[{"title":"Default Title","offer_id":45091852648692,"sku":"381","price":2.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/unnamed_6.jpg?v=1723316201"},{"product_id":"ourladyoffatima","title":"Our Lady of Fatima by Fr. Lawrence G. Lovasik","description":"\u003cp\u003eThe story of the appearances of Our Lady to the children at Fatima. Full-color illustrations. \u003c\/p\u003e\n\u003cp\u003eISBN: 9780899423876\u003cbr\u003ePages: 32\u003cbr\u003eAuthor: REV. LAWRENCE G. LOVASIK, S.V.D.\u003cbr\u003eSize: 5 1\/2 X 7 3\/8\u003cbr\u003eColor: ILLUSTRATED\u003cbr\u003eBinding: PAPERBACK\u003c\/p\u003e","brand":"Catholic Book Publishing","offers":[{"title":"Default Title","offer_id":45091852714228,"sku":"387","price":2.95,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/387-5.jpg?v=1763667411"},{"product_id":"divinemercynovenachaplet","title":"Divine Mercy Novena \u0026 Chaplet Pamphlet (English or Spanish)","description":"\u003cp\u003eDiscover the Prayer of The Divine Mercy and The Divine Mercy Novena given to Saint Faustina by Jesus, as well as illustrated instructions on how to recite the Chaplet of Divine Mercy.\u003c\/p\u003e\n\u003cp\u003eOne and a half million copies of this popular 10-panel pamphlet are distributed annually throughout the world.\u003c\/p\u003e\n\u003cp\u003eNewly Expanded Version Available in Spanish and English!\u003cbr\u003e\u003cbr\u003e\u003cbr\u003e\u003cbr\u003e\u003c\/p\u003e","brand":"Marians of the Immaculate Conception: National Shrine of The Divine Mercy | Association of Marian Helpers | Marian Press","offers":[{"title":"English","offer_id":45091853435124,"sku":"LFMCN","price":0.4,"currency_code":"USD","in_stock":true},{"title":"Spanish","offer_id":45091853500660,"sku":"SLFMCN","price":0.4,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/lfmcn1.jpg?v=1714243518"},{"product_id":"thesecretoftherosary","title":"The Secret of the Rosary by St. Louis de Montfort","description":"\u003cp\u003e\u003cspan\u003eDo you pray the Rosary well?\u003c\/span\u003e\u003cspan\u003e \u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eWith well over 5,000,000 copies sold, \u003c\/span\u003e\u003cstrong\u003e\u003cem\u003eThe Secret of the Rosary\u003cspan\u003e \u003c\/span\u003e\u003c\/em\u003e\u003c\/strong\u003e\u003cspan\u003eis one of the most beloved classics of Catholic literature as it teaches its readers this very important and spiritually vital thing!\u003c\/span\u003e\u003cspan\u003e \u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eWritten by St. Louis de Montfort, this short and revelatory book describes the many mysteries of the Rosary and teaches us how to pray it with proper devotion to Our Lady and her son, Jesus Christ. \u003c\/span\u003e\u003cspan\u003e \u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eSt. Louis discusses the numerous intricacies and beauties of the Rosary with topics like:\u003c\/span\u003e\u003c\/p\u003e\n\u003cul\u003e\n\u003cli aria-level=\"1\"\u003e\u003cspan\u003eOrigins of the Rosary \u003c\/span\u003e\u003c\/li\u003e\n\u003cli aria-level=\"1\"\u003e\u003cspan\u003eMysteries of the Rosary \u003c\/span\u003e\u003c\/li\u003e\n\u003cli aria-level=\"1\"\u003e\u003cspan\u003eMiraculous effects of the Rosary \u003c\/span\u003e\u003c\/li\u003e\n\u003cli aria-level=\"1\"\u003e\u003cspan\u003ePrayers of the rosary \u003c\/span\u003e\u003c\/li\u003e\n\u003cli aria-level=\"1\"\u003e\u003cspan\u003eAnd many more!\u003c\/span\u003e\u003c\/li\u003e\n\u003cli aria-level=\"1\"\u003eSt. Louis’s humble but inspiring writing is the perfect way to reencounter the Rosary, or to try the devotion for the first time. A perpetual advocate for the Catholic Church’s honoring of the Blessed Virgin, St. Louis reveals her love for the Church in a new way in his meditations on the Holy Rosary.  \u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp\u003e\u003cspan\u003eSt. Louis De Montfort lived in the 17\u003c\/span\u003e\u003cspan\u003eth\u003c\/span\u003e\u003cspan\u003e century, but his many works of holy Catholic literature have lasted and grown in popularity, even till the present day. Author of the eternal classic, \u003c\/span\u003e\u003cem\u003e\u003cspan\u003eTrue Devotion to Mary\u003c\/span\u003e\u003c\/em\u003e\u003cspan\u003e, St. Louis has been teaching the Church and its members valuable lessons about Marian devotion for centuries with enormous spiritual fruits to show for it. \u003c\/span\u003e\u003cspan\u003e \u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eWith the holy instruction of St. Louis, you cannot fail to appreciate the greatest gift of Mary— the Holy Rosary. With it, we are sanctified and brought into the presence of God now and at the end of our earthly lives. \u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003eLOCATION: With Rosary pamphlets\u003c\/p\u003e","brand":"Tan Books | St. Benedict Press","offers":[{"title":"Paperback","offer_id":45091853566196,"sku":"106","price":7.95,"currency_code":"USD","in_stock":true},{"title":"Leatherette","offer_id":45091853598964,"sku":"9781618909237","price":19.95,"currency_code":"USD","in_stock":false},{"title":"Used Paperback 1977 Edition","offer_id":46983843086580,"sku":"88858","price":3.0,"currency_code":"USD","in_stock":false},{"title":"Used Paperback - ANF Publication","offer_id":47162722386164,"sku":"SOTR","price":5.0,"currency_code":"USD","in_stock":false},{"title":"Used Paperback 1991 Edition","offer_id":47180287148276,"sku":"99937","price":3.0,"currency_code":"USD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/cd5530fa85431dd857dfbbed75ca600f164815f5.jpg?v=1714243520"},{"product_id":"prayingfastingalmsgivingspiritualpracticesthatdrawusclosertogod","title":"Praying, Fasting \u0026 Almsgiving - spiritual practices that draw us closer to God","description":"\u003cp\u003eLocation: SP--\u003c\/p\u003e\n\u003cp\u003ePerrotta, Kevin\u003c\/p\u003e\n\u003cp\u003e\u003cspan style=\"color: #333333; font-family: Arial, sans-serif; font-size: 13px;\"\u003ePrayer, fasting, and almsgiving are often called \"spiritual disciplines.\" The term highlights their similarity to physical disciplines. But like a physical fitness program, we can go through the motions of these practices without deriving much benefit from them. Jesus wants the spiritual disciplines to work for us. Only the Holy Spirit can make us holy, but we can spur the Spirit to help us. That is what almsgiving, prayer, and fasting are: ways of seeking the Holy Spirit's help, ways of beginning to cooperate with his work in us.\u003c\/span\u003e\u003cbr style=\"color: #333333; font-family: Arial, sans-serif; font-size: 13px;\"\u003e\u003cbr style=\"color: #333333; font-family: Arial, sans-serif; font-size: 13px;\"\u003e\u003cspan style=\"color: #333333; font-family: Arial, sans-serif; font-size: 13px;\"\u003eIn this Bible study, popular Scripture commentator Kevin Perrotta selects six readings from Scripture-one Old Testament and one New Testament text for each spiritual discipline. Each passage confronts us with some of the most important aspects of these practices, showing us why we undertake them and how they can transform us so that we become more like the persons that God has created us to be.\u003c\/span\u003e\u003c\/p\u003e","brand":"Word Among Us Press, The","offers":[{"title":"Default Title","offer_id":45091853664500,"sku":"9781593251970","price":12.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/fed031ea3fabb098edde1cba8fa1e161380ebf84.jpg?v=1714243522"},{"product_id":"thirstingforprayer","title":"Thirsting for Prayer by Fr. Jacques Philippe","description":"\u003cp\u003e Philippe, Jacques\u003c\/p\u003e\n\u003cp\u003e\"What the world most needs today is prayer. It is prayer that will give birth to all the renewals, healings, deep and fruitful transformations we all want for society today.... I am more and more convinced that everything comes from prayer and that, among the calls of the Spirit, this is the first and most urgent one we should respond to.\" \u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003eMany have already benefited from Fr. Jacques’ best-selling book on prayer, Time for God. In Thirsting for Prayer, Fr. Jacques revisits some of the themes covered in that book and develops new insights that are both profound and practical. These reflections guide us with simplicity on the path to intimacy with God, helping us to develop an actual taste for personal prayer. This \"school of prayer\" opens us up to the encounter with God that transforms us from within.\u003c\/p\u003e","brand":"Scepter","offers":[{"title":"Default Title","offer_id":45091853893876,"sku":"72083","price":15.0,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/40f363218865b0a89fea6cc22961043f38d25f12.jpg?v=1714243529"},{"product_id":"grainofwheatanovel","title":"Grain of Wheat A Novel","description":"\u003cp\u003eBy Author Giesler, Michael\u003c\/p\u003e","brand":"Scepter","offers":[{"title":"Default Title","offer_id":45091853926644,"sku":"9781594170782","price":12.95,"currency_code":"USD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0698\/2080\/9460\/files\/c689756f3726c1702911da0f323555fbc9355c98.jpg?v=1714243531"}],"url":"https:\/\/stanthonyshop.com\/collections\/books.oembed?page=32","provider":"St. Anthony's Catholic Gift Shop","version":"1.0","type":"link"}